PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 259aa    MW: 29705.5 Da    PI: 9.787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038092genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.8e-091142132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg W +eEd++l  +v+ +G g+W+t++++ g
      Lus10038092 11 RGLWKPEEDLILRMYVQTHGEGNWATVSAKSG 42
                     788*************************9987 PP

2Myb_DNA-binding46.39.4e-1595140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E++l+++ +k+ G++ W++Ia +++ gRt++++k++w+++l
      Lus10038092  95 RGDMSDQEQDLIIRMHKLVGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 140
                      7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.49689IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.6E-19792IPR009057Homeodomain-like
SuperFamilySSF466892.51E-7943IPR009057Homeodomain-like
SMARTSM007171.4E-91091IPR001005SANT/Myb domain
PfamPF002499.3E-71141IPR001005SANT/Myb domain
CDDcd001673.25E-51489No hitNo description
SuperFamilySSF466898.58E-1975143IPR009057Homeodomain-like
PROSITE profilePS5129423.79890144IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-2293143IPR009057Homeodomain-like
SMARTSM007171.2E-1494142IPR001005SANT/Myb domain
PfamPF002492.8E-1395140IPR001005SANT/Myb domain
CDDcd001671.14E-1098140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDDDTQQVKK RGLWKPEEDL ILRMYVQTHG EGNWATVSAK SGLSSSSSSS SQLDWATSSF  60
SLCYSYTNAG FTGLKRGGKS CRLRWKNYLR PNIKRGDMSD QEQDLIIRMH KLVGNRWSLI  120
AGRLPGRTDN EVKNYWNTHL NNKRLSRVNK RPKMMNSNKN HRRSFKDEKP PQDSRLVSGI  180
KPTFTIVEDN QTTATDEAWI EAARNMNSYL IESPMPAAAR DTALMLDTND PFMPYLDPYL  240
FFPQPFESFI GDRDAFFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-187614340107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2308115e-60HQ230811.1 Linum usitatissimum clone 00101 microsatellite sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579667.13e-67PREDICTED: transcription factor MYB82
SwissprotQ9LTF77e-59MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A061GP132e-65A0A061GP13_THECC; Myb domain protein 82, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135452026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-58myb domain protein 82